PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009801775.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 138aa    MW: 15579.8 Da    PI: 10.073
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009801775.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.84.9e-132577557
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                    k+ +r+++NRe+ArrsR +K++ ++ L+ +v  L+a Nk    ++ee ++ + 
  XP_009801775.1 25 KKRKRMISNRESARRSRMKKQKLLQDLTGEVSRLQAANKNIMAKIEETTERYT 77
                    899*******************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-172185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.0482375IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-112375No hitNo description
SuperFamilySSF579595.38E-112576No hitNo description
PfamPF001701.0E-102576IPR004827Basic-leucine zipper domain
CDDcd147022.13E-142676No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MSALRQSASS SASEDDQRYA GMDEKKRKRM ISNRESARRS RMKKQKLLQD LTGEVSRLQA  60
ANKNIMAKIE ETTERYTVCT AQNNVLRAQA RELDDRLRYL NDVINDTGLA VDAADPLLKP  120
LQIPCSMQPI ASSGLFKF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0455720.0AY045572.1 Nicotiana tabacum bZIP transcription factor BZI-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801775.12e-97PREDICTED: ocs element-binding factor 1-like
RefseqXP_016500443.12e-97PREDICTED: bZIP transcription factor 53-like
SwissprotQ9LZP83e-35BZP53_ARATH; bZIP transcription factor 53
TrEMBLQ941L51e-85Q941L5_TOBAC; BZIP transcription factor BZI-4
STRINGSolyc01g100460.2.11e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA111261525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.16e-35basic region/leucine zipper motif 53